Checking if your kit is complete... Looks good Writing Makefile for FASTAParse Microsoft (R) Program Maintenance Utility Version 7.10.3077 Copyright (C) Microsoft Corporation. All rights reserved. cp lib/FASTAParse.pm blib\lib\FASTAParse.pm Microsoft (R) Program Maintenance Utility Version 7.10.3077 Copyright (C) Microsoft Corporation. All rights reserved. C:\cpanrun\build\5-10-0\bin\perl.exe "-MExtUtils::Command::MM" "-e" "test_harness(1, 'blib\lib', 'blib\arch')" t/*.t t/00.load.......1..1 ok 1 - use FASTAParse; # Testing FASTAParse 0.0.2 ok t/FASTAParse....1..19 ok 1 - use FASTAParse; ok 2 - NR FASTA object ok 3 - loading NR ok 4 - access NR sequence ok 5 - validate NR sequence ok 6 - access NR id ok 7 - validate NR id ok 8 - access NR descriptors ok 9 - access NR comments ok 10 - validate NR comments ok 11 - validate NR descriptors ok 12 - access NR FASTA dump >gi|78925963|gb|ABB51603.1| RNA polymerase subunit B [Streptomyces violaceusniger] gi|78925959|gb|ABB51601.1| RNA polymerase subunit B [Streptomyces sp. NRRL B-24364] gi|78925957|gb|ABB51600.1| RNA polymerase subunit B [Streptomyces sp. NRRL B-24363] gi|78925953|gb|ABB51598.1| RNA polymerase subunit B [Streptomyces sp. NRRL B-24361] gi|78925951|gb|ABB51597.1| RNA polymerase subunit B [Streptomyces sporoclivatus] gi|78925949|gb|ABB51596.1| RNA polymerase subunit B [Streptomyces malaysiensis] gi|78925947|gb|ABB51595.1| RNA polymerase subunit B [Streptomyces rhizosphaericus] gi|78925945|gb|ABB51594.1| RNA polymerase subunit B [Streptomyces yogyakartensis] gi|78925943|gb|ABB51593.1| RNA polymerase subunit B [Streptomyces indonesiensis] gi|78925941|gb|ABB51592.1| RNA polymerase subunit B [Streptomyces cangkringensis] gi|78925939|gb|ABB51591.1| RNA polymerase subunit B [Streptomyces asiaticus] gi|78925937|gb|ABB51590.1| RNA polymerase subunit B [Streptomyces yatensis] gi|78925935|gb|ABB51589.1| RNA polymerase subunit B [Streptomyces melanosporofaciens] gi|78925931|gb|ABB51587.1| RNA polymerase subunit B [Streptomyces hygroscopicus subsp. hygroscopicus] gi|78925925|gb|ABB51584.1| RNA polymerase subunit B [Streptomyces violaceusniger] gi|78925923|gb|ABB51583.1| RNA polymerase subunit B [Streptomyces violaceusniger] gi|78925919|gb|ABB51581.1| RNA polymerase subunit B [Streptomyces hygroscopicus subsp. geldanus] gi|78925917|gb|ABB51580.1| RNA polymerase subunit B [Streptomyces sparsogenes] gi|78925913|gb|ABB51578.1| RNA polymerase subunit B [Streptomyces hygroscopicus subsp. hygroscopicus] ;from GenBank nr RNVGELIQNQVRTGLARMERVVRERMTTQDVEAITPQTLINIRPVVASIKEFFGTSQLSQFMDQTNPLSGLTHKRRLNAL GPGGLSRERAGFEVRDVHPSH ok 13 - print FASTA test ok 14 - creation of FASTA ok 15 - manual id check ok 16 - manual sequence check ok 17 - manual comments validation ok 18 - manual descriptors validation ok 19 - save to file of entry ok t/pod...........1..1 ok 1 - blib\lib\FASTAParse.pm ok All tests successful. Files=3, Tests=21, 0 wallclock secs ( 0.00 cusr + 0.00 csys = 0.00 CPU) Microsoft (R) Program Maintenance Utility Version 7.10.3077 Copyright (C) Microsoft Corporation. All rights reserved. Installing C:\cpanrun\build\5-10-0\html\site\lib\FASTAParse.html Installing C:\cpanrun\build\5-10-0\site\lib\FASTAParse.pm Appending installation info to C:\cpanrun\build\5-10-0\lib/perllocal.pod